SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.209489|PACid:15708017 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.209489|PACid:15708017
Domain Number 1 Region: 92-146,174-231
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 2.49e-31
Family L,D-transpeptidase catalytic domain-like 0.00054
Further Details:      
 
Weak hits

Sequence:  Aqu1.209489|PACid:15708017
Domain Number - Region: 42-78
Classification Level Classification E-value
Superfamily LysM domain 0.00288
Family LysM domain 0.01
Further Details:      
 
Domain Number - Region: 194-307
Classification Level Classification E-value
Superfamily Arginase/deacetylase 0.0268
Family Arginase-like amidino hydrolases 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.209489|PACid:15708017
Sequence length 316
Sequence
MRVGAEIAADGIAASASENAWGVVNAWELPDGDQSVVGEPSIHSADYEDTLLDIARRFGM
GLEEIKLANPGVDLWIPGEGTPVQLPMHFVLPNAPRRGLVVNVPEMRIYHYSDDGKSVRT
FPISIGRVGWETPLGETTVTRKKAGPNWYPPKSIREEHAARGDILPKVVRAGPENPLGSH
AIYLGLPAYLIHGTNRPFSIGMRVSHGCIRLYPEDIPELYALAEKGMPVNLVHQRVKMGW
RGDRLYMEVHPEAKVEEAKAKPDLSEAVEALYRLLPKGMAYLEVDWDLVRRTLVLANGTP
VSIGFRPPAEQEEEIS
Download sequence
Identical sequences Aqu1.209489|PACid:15708017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]