SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.209495|PACid:15708023 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.209495|PACid:15708023
Domain Number 1 Region: 531-835
Classification Level Classification E-value
Superfamily DNA primase core 3.92e-92
Family DNA primase DnaG catalytic core 0.0000000999
Further Details:      
 
Domain Number 2 Region: 415-511
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 4.25e-34
Family DNA primase zinc finger 0.00016
Further Details:      
 
Domain Number 3 Region: 875-982
Classification Level Classification E-value
Superfamily DNA primase DnaG, C-terminal domain 0.000000000000602
Family DNA primase DnaG, C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.209495|PACid:15708023
Sequence length 1032
Sequence
MAGHRFSRIEVIDGFLFEPGLREDRRCFVDAGGRSRCRDRDRSHRLPCGIDRLGPRGSSN
ARFARSARRRVQKPGGDQYASYRGQESGGVDLGRGYAQRNGIGIARSVVGARSGGARIAG
RFFGASLSDLVSLPRGQGDGDPARRARGFRLALGPRFGGDMAGGRPLDSLFIAGFDDECG
RGLCGFFLDADREPDSHRLRSSRPRADRDPRSVAASRQYSASRRRERESDRSKKGMRAPR
IRRSKEPGMKRLQGNPRYRGVLIKTIQGGRRSSSLQRTLIPKECASPLAFSDAESGEKRR
LPARDHRRLYARPPRRGGDRRSRSRGHRALGGKRFEADGGGDGSSQAPSQRSRRHGQGER
EGKGSPSRLKKPVFARAAPQAPELERPESSGSKQGASARISSHRWFRGGCGLAGRIPRSF
VDDVLARTDIAEIIGHYLRLVPAGKDFKSLCPFHSEKTPSFTVVPDKQFYHCFGCGKSGS
AIGFLMDYANMDFVEAVEDLAHRLGLEVPREADDRRPAADNDRSAGDHAAIYEMLERANR
FFRNGLRGSKTAKEYLKGRGLGGEIARDFQIGFAPPGWEALLSHLGKSASERDILVAAGL
VIRREEDGRLYDRFRDRITFPIHDTKGRVAGFGARIIGVGEPKYLNSPETKVFHKGRELY
GLWRLRRPGVVRPKRLLVVEGYMDVVGLARSGIDGAVATLGTSATLDHIRALFRFAGDIV
FCFDGDEAGRRAAWRALENTLPAMHGEDRQIRFLFLPEGDDPDSLARREGCEAFDERLQG
DAIEMSRYLFEHQEEGLSLRSAEGRSRLVARLLPLIRRIPSGPYRRQLEMQLADISKDRT
VISFDETLVEGHRSPGSPYESKSSAKRREASRPRQTLMRQAVRILVYEPQVALDVEDEDL
EPIRDAAAGLPGAEVLIDLIESVRRRPDISAGRLRERYRGHRWERSILALSHDPPELFGK
GDMKIEFADCLRRMREQAKRRKRALTRDALAAAGGARGSSLGKSDRSSIPDRKADAVDKD
IERPSQEGDDDE
Download sequence
Identical sequences Aqu1.209495|PACid:15708023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]