SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.210730|PACid:15709258 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.210730|PACid:15709258
Domain Number 1 Region: 159-346
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000409
Family RecA protein-like (ATPase-domain) 0.069
Further Details:      
 
Weak hits

Sequence:  Aqu1.210730|PACid:15709258
Domain Number - Region: 6-75
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0628
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.210730|PACid:15709258
Sequence length 543
Sequence
MLVFKRWFDANRDVNWDTLVKLCNSFPDKLGKAKSNLLTYIGQSIPDKVNSHTVLPSPVD
DISNTPVTNIRGESDVATPISSIPDDVQGYVDNMRQHYKHQPIVATDWPPRIGKDFFGRL
ALVEKQDSSTQAESAWHLLRGQVDKTVKLTENKEISVEDVLQPTDSSLSLRVVIDGPPGI
GKTTLCRKLLNMWSNRPLVPQQYDLVLYCPLRNSKIATATTLADLFEYRCYEVPMVAEWF
EKRNGEGLLIIFDGWDELSEQLRQSSLAASIIYRKQLNKCSVIVTSRSYASSLLLKIDTL
SRHVQVIGFSEEEISTVIIQTFQKHAKLAQELIDENTEQILPALWQSSKYKSHFTTNQSS
KDSQLAVQLINDLKVRNDVKSLCYIPLVCSMVILVYSKEGGHLPTTLTQLYENFILQTIK
RHVEIKLELGINPRTLGSLSSLPSQLAKPLQEMCQLAYTNLVNTRMTFPSHQLQSLSEAV
KEDYLGLMTTFTEYDEEKYRFLHLSIQEFLAAWWIAKHEKKTEELLYQQFQHNMESLAPG
QCT
Download sequence
Identical sequences A0A1X7TMW4
Aqu1.210730|PACid:15709258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]