SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.220238|PACid:15718766 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.220238|PACid:15718766
Domain Number 1 Region: 459-560,984-1101
Classification Level Classification E-value
Superfamily PIN domain-like 5.89e-54
Family 5' to 3' exonuclease catalytic domain 0.001
Further Details:      
 
Domain Number 2 Region: 106-325
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.24e-46
Family C-terminal domain of adrenodoxin reductase-like 0.00000338
Further Details:      
 
Domain Number 3 Region: 1086-1127,1157-1195
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 4.49e-17
Family 5' to 3' exonuclease, C-terminal subdomain 0.003
Further Details:      
 
Domain Number 4 Region: 16-162,328-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000311
Family C-terminal domain of adrenodoxin reductase-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.220238|PACid:15718766
Sequence length 1196
Sequence
MTSFKSNNAALSGGRRGLTRIAIVAQQCDDVRVDIFEALPVPFGLIRFGVAPDHPEVKNV
INQFTTLALTDRCRFIGNINIGTDININQLRSYYNGVVLAYGAEEDKTMGIKGEDSYGVF
SARSFVSWYNGLPGYENLNLNLSSGDTAVIIGQGNVALDIARILLTPLDTLKETDICSHA
VDALSFSKIKKVIMVGRRGPLQVAFTIKELREMTKLPQCKTMIKHKDMLPYKDIISELPR
PRKRLTELMLKTSSDGRDISNDDNVLELLFCRSPMEIIARNEITKGIKLEINELIEDANG
GNTTAVGSGEYETIDCSMVLRSIGYKSRNIDPEIPFDEKLGIINNSKGRVVNNGTTINGL
YCSGWVKRGPTGVILTTMNDAFETAGSIIEDNKNGMLPSSNTARDILNDIKGFEPVLFED
WLKIDEEEKRRGELVGKPREKIVSVLEIGHGLTRDVTMGVKDLWKILEPSGRAINPETLK
GQILAVDVSIWLNQAIKGARDHHGNEIPKPHLLVLFNRICKLLFYQIRPVFVFDGPPPPL
KTKTLELRRRKRKEAGKAAGELMDKRSRKLLEAQAIKTITGKELDIPSYIKKTNIEEDMF
YLPEKDSALVNQSIEEISEHEDTNYFDDHSYRDDDNIDVNSESFSCLPPEIQHDLLLEKK
EKERTARCDPMALPKDANDFSNYQLSRVMRRSQLSRKLGDVRKTLNRSQSNSLGIPQGTN
VQVEANRILSTEERRYILIQGTDSFISSSTMEEATDSQHITDTPDIQERSDDFTTGNASP
LDTLVAASEMGFHSPVAADEMNAPTASNVVKNVVSPTAGKMDSPTTDDVRNSPTAGKVGS
PIVATPPVTEADPPEHYDAKEDDTVHLSRDASQTDISDSNVLQHLPVEKLANNQTILINE
SSSESEIEFEEVKIDEPLTINKETTEEKRTNYDERIEEKEEEKREEEERGKEGSAINEEE
MVAAVEDAKELMELPTKEMEVRITEELESINKETNKQERRTAGLTTSIIEEAKELLRLFG
LPYLESPSEAEAQCSTLESLSLTQGTITDDNDVFLFGGMNVYRHMFTGSHDVEYYRNADI
ETLLGLDRNNLIILAYLLGCDYTDGIEGVGVVNALELVQFFKGEGLEPLIKLKQCNIDCN
TVNNLKESPLQKKIRGLSFPDDFPNVLIRDQYMRPAVDDSKETFEWGTADLDLIRE
Download sequence
Identical sequences Aqu1.220238|PACid:15718766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]