SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.223170|PACid:15721698 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.223170|PACid:15721698
Domain Number 1 Region: 355-613
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.72e-24
Family RecA protein-like (ATPase-domain) 0.026
Further Details:      
 
Weak hits

Sequence:  Aqu1.223170|PACid:15721698
Domain Number - Region: 183-279
Classification Level Classification E-value
Superfamily DNA primase core 0.00785
Family Primase fragment of primase-helicase protein 0.019
Further Details:      
 
Domain Number - Region: 43-72
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0289
Family PhnA zinc-binding domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.223170|PACid:15721698
Sequence length 682
Sequence
MATGLFLSRFFVSYFSSASHSIRAELEKRGLKFTTGVTSLKVSPCPHCTAQSSTLFIQPD
GKWVCTPCKKSGTKKDLFSSEVKGQAKETALKNRPTNATIKANGPLKMAKNIKLGSISPT
LTPKGLKFNGTSKDPVMMTADTNDDDDVLSSTSTLPSPLKSQKESIVSLPINDKVKKLFA
IEKLSTDVIQRYSVTLHLDNEKSSLIFPWYSYSLLSNFNRTGSIENGEMVLTPSDGELPL
NRSVFGWHDIKRTGTKELIVTDAEIDAMAAFQGSTLDSIAMNLKPFSALPPQLLKDLEEM
DKIFIWPRDSSSSLVSGLPRLLNKPVCWTINEFTQDGKRLSPLDALNNGLSFRTIIDSAK
PASHKEILYFHQLENNVYEEFLNTEKVAGVKWKRFSKLTAILKGFRPGELTIFTGPTGSG
KTTFMSEMSLDLCQQGVSTLWGSFELSNVRLIKTMMKQFSGVNFDDHLNEYQSYAEKFRT
LPMHFMKFHGQTELTKVIEAMTHGVMVNGIQHIIIDNLQFMIGMKSKCFEDSFHAQNAVF
AEFRHFATEHNVHITVIIHPRKEDPDRPLKTSSFFGTAKATQEADNILILQSIGRDKFLQ
ITKNRFSGNLGNIKMLFDTNSLTYSGMFKKVATSPVVGDISKSSFVKKQEEPLAHNVVNN
HVKLPTGIMKPTPFKPIIINKY
Download sequence
Identical sequences A0A1X7V6F9
Aqu1.223170|PACid:15721698 XP_003385622.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]