SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.225267|PACid:15723795 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.225267|PACid:15723795
Domain Number 1 Region: 7-160
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000642
Family G proteins 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.225267|PACid:15723795
Sequence length 215
Sequence
MAEDIPSYKVILAGLKGVGKSTLLGMLDSKVDVEFGESILLSVEKGESSRGRTKLKIETK
CNDSVIYVWVWDTAGMEKHSGSIGMTKSYFQEAHGAILVYERGRDETKTALQEWAKLTRA
ESPDCVLSLWCNNRNEEIGTSELTRDTLTDIASHYKIKDHLMFTYVPGRDTEVVHTYFNT
LMCEIHRKLPPRRPHSESVKLESDHSNKKCCSKRQ
Download sequence
Identical sequences A0A1X7VE12
Aqu1.225267|PACid:15723795 XP_011402476.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]