SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.200116|PACid:15698644 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.200116|PACid:15698644
Domain Number 1 Region: 30-250
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.59e-57
Family Phosphate binding protein-like 0.00000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.200116|PACid:15698644
Sequence length 250
Sequence
MTRSFTTARTLVLSALTTLVLSSSAFAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGI
KVTIEHPDKLEEKYPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEIHPSKAFQDKLFPFT
WDAVRYDGKLIGYPIAVEALSLIYNKDLIKQAPKTWEEIPALDKELRAKGKSAIMWNLQE
PYFTWPIIAADGGYAFKYENGKYNIKDVGVANTGSQAGLQFIVDLVKNKHINADTDYSIA
EAAFNKGQTA
Download sequence
Identical sequences Aqu1.200116|PACid:15698644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]