SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.204432|PACid:15702960 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.204432|PACid:15702960
Domain Number 1 Region: 44-142
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000796
Family Phosphate binding protein-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.204432|PACid:15702960
Sequence length 171
Sequence
MVVGFSFDCSKNRRDDLEDHAIIGNFYLDAAAIEPGPLPAYVPRLEISRGQERFTLPTYR
RFLSTDHSQILELVKHGRVIAPITGIWALPGLLSGELVRILPDYEISESPQLYALYLDRL
ASIPKLKVFLDFIEEIVKRLTKEWQPQADKLFPKQNLVLFPSINFQTRNDS
Download sequence
Identical sequences Aqu1.204432|PACid:15702960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]