SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.206098|PACid:15704626 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.206098|PACid:15704626
Domain Number 1 Region: 28-368
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.39e-105
Family Phosphate binding protein-like 0.0000000000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.206098|PACid:15704626
Sequence length 369
Sequence
MVTLRKKWLSGVVAGLLMAASVTASAEEKTLHIYNWSDYIAPDTLAKFQKETGIKVVYDV
FDSNEVLEGKLMAGSTGYDLVVPSSNFLERQSKAGIFEPLDKSKMPNYKNLDPEMLQLVA
HNDKDNKYGIPYLMVTTGIGYNVDKVKAVLGKDAPVDSWDLILKPENLEKLKSCGVSFLD
APSEVYATVLHYLGKDPNSTNAADYTGAANDLLLKLRPNIRYFHSSQYINDLANGDICVA
IGWSGDVMQAANRAKEAKNGVNVAYAIPKEGALTYFDMFAMPADAKNKDAAYQFLNFLMK
PDVMAGISNFVYYANAVKDSTPLVNAEVRNNPNVYPPADLRAKLFTLNVQSPKLDRVITR
AWTKVKSGR
Download sequence
Identical sequences A8GCA9
WP_012006078.1.18676 WP_012006078.1.35080 Aqu1.206098|PACid:15704626 gi|157369888|ref|YP_001477877.1| 399741.Spro_1645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]