SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.208041|PACid:15706569 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.208041|PACid:15706569
Domain Number 1 Region: 87-304
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.9e-38
Family Phosphate binding protein-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.208041|PACid:15706569
Sequence length 391
Sequence
MRAIKSGLLRILVFVSLSSASILRGRIGDPSTISIDRLAGGGIGSIHLPRSFLQGGLKMN
KRIRGSLGAALALSVLTSLQGAQAADVTVGYQLVYGPWKAKMEELKEDGLGGKTIEFVKF
TSGTEVINAMASGSVDIALNGSSPTAAGYSRGVDLQVIYVYDNINDAEALVVDETIVAPQ
DLRDKKIGVPFGSTTHFHMMFALEQFGMSPRDLDVLDMSPPDMVAAWERGDINGGFVWDP
ALGSMKKKGRILLTSGDLSNWGKATFDAMVARKGFTSEHPDFACQWVKMVSKADADYRSN
PADYGPGTMKAMGVAKAVSGDEGQVGMVLSLYDYPTLEEQVSSTWLGGGVQNALRAASEF
LVSQGKLDGVLDSYADSATPKFAQMVLDGGC
Download sequence
Identical sequences XP_019860400.1.10788 Aqu1.208041|PACid:15706569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]