SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.215320|PACid:15713848 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.215320|PACid:15713848
Domain Number 1 Region: 199-641
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6e-65
Family Tandem AAA-ATPase domain 0.045
Further Details:      
 
Domain Number 2 Region: 913-979
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000000017
Family AN1-like Zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 707-766
Classification Level Classification E-value
Superfamily R3H domain 0.000000000000667
Family R3H domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.215320|PACid:15713848
Sequence length 1025
Sequence
MEDFVEKHLELIEQERQEEVAQGLSLLSTDLKNIKELETKGVCLSKLGIESERIGLFGRH
IVTFSHRLGRHKLPTHSITCGDIVGIFSKGQSLLPGQLVSGVVVKSSDVHLGVAFEELPE
EVSLGGLGDCLQVVKLANDITYKRMKRALNDLKSMDPILSSHLVDVLFQATPPGPSHSKW
TYQLDQLQTQFDSSDFKFFNQSLDSSQKRAVFFALSRPDVAIIHGPPGTGKTTTVIEYIL
QETLTLNNKVLAVAPSNIAVDNLVERLAASSPKLKIIRLGHPARLVQSVLQYSLDSILAS
TDGSDIVLDVRKEMSSAWSKAGNAKSSSERRKWHTEAKTLKKELIEREEKLVQQILSGAN
VILATNTGATPTGPLKHLPIDHFDVVVIDECAQSLEASCWIPLSRAPKCILAGDHKQLPP
TILSDKAARDGLAVTLMERLVSVYRDQVTTLLTTQYRMNHNIMKWPSQYLYEDSLTAHES
VSHHLLKDLPTVTITTATTIPLLFIDTASCGLYELDTPSEESKGNEGEAEIVLAHVKELI
GAGVREGDIAIIAPYHLQVGMIRERLEANGISTGKVEVHTVDGFQGREKEAVIISFTRSN
KKGEFGFLKEQRRTNVAVTRARRHLAMVGDSETISREPFIKGLLEYCTNNGEVYSAHEYI
DTASMIQAESVATDQQEGFAIKPVEEIKKKDPPSPAVDSNKLAQQRLSYEKQLKEFKKSS
EEQSSITFPNTLSSSQRKIIHELSEELGLSHVSHGEGNDRYIVVSRSRKTNGAECSDSTT
EDDKIQQPLMIKAPQIEDTVCCIDEETISIDVTEKKNLSKVASLPPPSEAKTKIDVKSKA
KDEVIVGATVGVWQCQICGIHLPKENSELHQLRCEREKRRVEDIVKKKKQESELKSKGSQ
KKTKSEKAKPVEQLDDLDLLLEEMKKADKTCNFSGCKKSVNHLGIICPFCKKKYCMTHNI
AETHGCEERARRMARKDLEKELRGDGKGTTAGRKSDSSKRAHLQRKLDKKINDLSADRQR
KKPSS
Download sequence
Identical sequences A0A1X7U8F4
Aqu1.215320|PACid:15713848 XP_003388772.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]