SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.216459|PACid:15714987 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.216459|PACid:15714987
Domain Number 1 Region: 20-107
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00000772
Family Apolipoprotein 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.216459|PACid:15714987
Sequence length 266
Sequence
MSFLSGVGDAVDGLKGLQELPELVEGQISKIPDKIGDELQKIPDRVGTELEKTSDKIQEQ
LAKVSETVEGELPKMSQQVGSQMEGINERIQEQLKNTSQMVQEELQKVPAIVSEELSVFP
QKMVSASASVLKESAKEGCYDCMSEYPGCWCCWLCCKCCLWTCCCGYCKSCCGPPPRNPP
PAPQQQRRNEEPVRQQPRQARQQQPKTQEEPQAAVPKSEEPVAQATAVEPKAKEPEPKAE
EPEPKAEELEPKAEEPEPKAEEPKSE
Download sequence
Identical sequences A0A1X7UBX8
XP_003388371.1.10788 Aqu1.216459|PACid:15714987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]