SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000128924 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000128924
Domain Number 1 Region: 211-322
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-28
Family B3 DNA binding domain 0.00000512
Further Details:      
 
Domain Number 2 Region: 76-133
Classification Level Classification E-value
Superfamily DNA-binding domain 1.83e-17
Family GCC-box binding domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000128924
Sequence length 406
Sequence
MDGISSTEESTSSDSISISPLQHIVARVDPFAKSAPQVASLCRVGSGASSVILDPELSSS
GGTGGVEAESRKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDVAAQ
RFRGRDAVTNFKPSSAEPISSDDEENDDAEAAFLSSHSKSEIVDMLRKHTYNDELEQSKR
NNSAYGKRSRSNGSLGLFGTDNSGVPKAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFP
LQSGSAATLTVSASTACKGVLLNFEDVGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNL
MAGDIVSFQRSTGPDKQLYIDWKARMSVNNTNNNGSSPVQVGPVPMVRLFGVNIFKIPGS
SGPGSADAAAAAAIGGGCNNNIGKRMREMELLELEFGKKPRIIGAL
Download sequence
Identical sequences MDP0000128924|PACid:22664801 MDP0000128924 XP_008350869.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]