SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000138860 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000138860
Domain Number 1 Region: 144-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-31
Family B3 DNA binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000138860
Sequence length 665
Sequence
MAPRTTGVEGPPRTATVNAGESSGCTDAAALPAANNDQGEKDDLYTHLWYACAGANVYVP
RPGEKVFYFLQGHXEQVEAYANQDGKMEMPRYNLPPKILCNVVCVQLKAEVHTDEVYAQI
TLLPVTEQDQLSVEEXNTPPLPXRTSTXSFSKTLTPSDTSSHGGFSVPKRQAEECLPALD
MSQQPPVQDLVAKDLQGNEWSFRHIFRGQPRRHLLTSGWTTFVTAKRLVSGDACIFASMQ
HGILASAFHAISTGTIFTVYYRPWTSPAAFIIPYDRYMKSAEIDYSIGMRFRMYSEGEEC
ADQKKRXSSHDLRMQEWMDKNIEDNDYLRWPDSEWRCLKXRLDTASDTCFHSERLSPWNI
VPLKPNKRARLPDLPSPGISSLARNGSLLISVESTRPRKKKVFQGQETSDPPAHEPGTPK
QLLQFIPPPNPDWDYTXLGLENNLNVPMNDSFYQCPGSPKAPSLTNQWPPMFGFGVFDSG
ACKRSMSVPNIWSSXSQKLRTFELXSETQSPLVQPKTTMLFGVKIVTSYPELPSPQVANS
IELYSPCSTPPIYHSSVSETIQLSETSKSVSGVRSEKQCRKCCSVSNRSRIKVLKHGAPV
GRSIDLTRFDGYNELIRELDQMFDFKGSLIGGSSGWQVTYMDDVGDRMLVGDYPWQLRTR
TYAVT
Download sequence
Identical sequences MDP0000138860|PACid:22643076 MDP0000138860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]