SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000141094 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000141094
Domain Number 1 Region: 222-518
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 4.45e-102
Family Cryptochrome/photolyase FAD-binding domain 0.00000000065
Further Details:      
 
Domain Number 2 Region: 6-119,158-206
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 5.02e-36
Family Cryptochrome/photolyase, N-terminal domain 0.00000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000141094
Sequence length 706
Sequence
MSGXKTIVWFRRDLRIEDNPALAAAARDGSVFPVYIWCPKEEEQFYPGRVSRWWLKQSLA
HLDQSLKSLGAELVLIKTQSTLAALIECIQAIGATKVVFNHLYGHVTNLTENQFIKSTIR
LRVGGQPFSVVLLNPVSLVGDHNIKGKLVELGISVQSFNADLLYEPWEVYAGKGQAYTTF
XVYWDKCLHIQRELVTRLPPWKLISATGTVAKCSLEELGLENETEKSSNALLRRAWSPGW
SNADKALSEFFELHLLDYSNNRMKVGQNSTSLLSPYLHFGELSIRKVFQSARMKQILWAK
EGNSTGEESVTLFLRAIGLREYSRYLCFNFPFTHERPLLSNLKFFPWQADQANFKAWRQG
RTGYPLVDAGMRELWATGWIHNRIRVIVSSFXVKVLLLPWRWGMKYFWDTLIDADLESDI
LGWQYISGSLPDGHELERLDSPEVQGSKFDPEGEYVRHWLPELSRLPTEWIHHPWDAPDS
VLKVSGVEFGFNYPKPIIEIDLARERLTSAIFKMWEMEAAAKAASSNGTDEVVVDNSISE
DLPIPKVILKKTSPCPTYSSNDQKVPTCQNSKNNQFIRKRSKFMQDESPLPDNPHNPNEA
GPSRTNEDTSSTAESSISKKQTTSRNSFSVPQSCSSSEGNPXMGCESSEMKQSWQEQSDM
EQSSSKNGTIRDANLGMYLAGLFGGXEGMTDDSIXEFVSIFCSPNQ
Download sequence
Identical sequences MDP0000141094|PACid:22642517 MDP0000141094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]