SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000166580 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000166580
Domain Number 1 Region: 797-878
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000018
Family B3 DNA binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000166580
Sequence length 934
Sequence
MAWVNDDEGEQMIRLRHRTVAPFRWERKAGVTISGVKAEKVEARDQNPGKKPIQRYLRKT
KQKTRTKNKNXQKSWRCKYIETPQNIPEHTWGLLRAFPVPPPFNHAPFLSTHLKKIDHFS
PPLFYSLSTAAPSGSSRACEELGFIEVAFLLICTELVFGSKVSREMKGEQVQVQVPVHHQ
HQDLHAGDLDTLGVDPRKMWLDDDQETTLDVNDPSIFYNDKFPPLPDFPCMSSSSSSSST
PAPVKTVTCSSSSPSVSSSSSAASWAVLKSDAEPEDGERKQQQHNSYHHQYSQIDDQTVD
AHALSSTVSMEISQPLDLSGGIDCMDEMGTFGYMDLFESNECFDPSSIFQSDSLFMEQFQ
QDQDNQHLAMAHQLQDHHEIATTIQSNPQQQKQVVGQDEENTNKDQSNDKKDPDDMAMVF
LEWLRSNRETVSAEDLRSVKIKKSTIECAARRLGGGKEAMKQLLKLVLEWVQTNHLQKRR
SNSITTKDSNLIAQQQYQDPYQNPNPNSIPRVLESNPSCNFTQRPCMAPPPHAAAYDPAX
GGLLVPIPPPASPPPAAYPSMMGYMTADPFGNGPSSYQPSPEYHHHMIDSGQPSWQSSPF
GMVGTAPYGSFPDNNIHLAPPQHHPQAFAGYSSQYQPYQYFPGNGERQLMRLGPSATKEA
RKKRMARQRRLVSHHRHHGHQQNSQQLNNEMPDHNYLQQTRFVGNTTDLNCTGAVPLQPN
PGNWFYWPTATAALSSSAVAMMPSIMPEAAPLPPVQQMDRPASNQAQNYNQGRSAAQERQ
ERQERRQGWKSEKNLKFLLQKKEAETHLPELDARDGISIAMEDIGTSRVWNMRYRYWPNN
KSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCNKYMIRGVKVRQEGPKSEGNKRPGKTQ
RNQHASTPAVNNGSSPSSATTAHKKITVKSKARK
Download sequence
Identical sequences MDP0000166580|PACid:22637283 MDP0000166580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]