SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000174367 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000174367
Domain Number 1 Region: 209-520
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 7.46e-94
Family Cryptochrome/photolyase FAD-binding domain 0.0000143
Further Details:      
 
Domain Number 2 Region: 5-188
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 4.97e-46
Family Cryptochrome/photolyase, N-terminal domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000174367
Sequence length 592
Sequence
MSSGSSSLMWFRKGLRIHDNPALEYASKGSDFLYPVFVIDPHYMKPDADAFSPGSSKAGL
NRIRFLLESLSDLDSNLKKLGSRLLVLKGEPSEVLNRCLKEWDVKRLCFEYDTEPYYQAL
DVKVKGYASAAGIEVFSPVSHTLFNPADIIRRNGGRPPLTYQSFVKLVGDPSWASSPLSI
TLSSLPPIGSFGRCEISEVPTVEELGYEETQQDEHSPFKGGESEALKKLRESIEKKEWVA
NFEKPKGDPSAFLTPATTVLSPYLKFGCLSSRYFYICLQDLYKNVKSHTSPPVSLAGQLL
WRDFFYTVAFGTPNFDRMRGNKICKQIPWNDDDELLQAWREARTGFPWIDAIMIQLRKWG
WMHHLARHSVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQTYN
TANDDTFSGYMSCDFLTYNRIYSPTSFGKKYDPNGDYIRHFLPVLKEMPKEYIYEPWTAP
ESIQKKAKCIIGRDYPKPVVAHDSASKECKRRMAEAYALNQKLTGLVSEEDLRNLRRKLE
KDEKPEKFKVVNEPTPELNVIVPKFGLCNFSPARVSLKIASPIPSSSCFELF
Download sequence
Identical sequences MDP0000174367|PACid:22650301 MDP0000174367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]