SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000191389 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000191389
Domain Number 1 Region: 65-237,331-441
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.19e-44
Family FAD-linked reductases, N-terminal domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000191389
Sequence length 530
Sequence
MDYQYVLGGVLVSLLGSVFFMIINTTLSGEKKKVVEKVSRGINGDGYVRMPSQNGSFQPE
IASCTDVVIVGAGVAGAALAYTLGKEGRRVHVIERDLSEPDRIVGELLQPGGYLKLIELG
LADCANESIDAQKVFGYALYKNGNDTKLSYPLEDYTSDIAGRSFHNGRFIQKMRERVATL
KNVTLEQGTVTTLIEEKGTVKGVMYKNRAGEEMRSYAPLTIVCDGCFSNLRRNLCTPKVD
NPSCFVGLILENCDLPHANHGHVILGDPSPILFYPISSTEVRCLVDVPGTKVPSVANGEM
AKYLKTVVAPQVPPQLLKSFLAAVKKGNIRTMQNKSMPATPVPTPGAILLGDAFNMRHPL
TGGGMTVALSDIVLLRDLLRPLTDLSDASALCEYLESFYTLRKPVSSTINTLAGALYKVF
CASPDPARQEMREACFDYLSLGGICSYGPISLLSGLNPRPIHLFLHFFAVAVYGIGRLMI
PFPTPKRVWLGTRLILGASGIIFPIIKGEGVRQMFFPATIPAYYNAPPLQ
Download sequence
Identical sequences MDP0000191389|PACid:22631180 XP_008356343.1.92800 MDP0000191389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]