SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000197534 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000197534
Domain Number 1 Region: 154-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-17
Family B3 DNA binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000197534
Sequence length 277
Sequence
MNPKRNTRLGESSRQDMDDRDHEEDPDCKDKSMTMKEGALILIHMKHKVLDSDSARELEN
MKCKFLGSNYWKKKYSHEGTTRKRIIQETEAPKTLEAVYNVAAAQGQQPLTGELQKLKDE
EVEAEGLFYGNYAPPDVPHVPRIQHLIQVCSKPFEKQLTSSDVRDGQCRFAINKEDVENH
IFLLLKKGEDIRKGIHVTTYDVDGNDYPMVYKLWAGKIHVLTGGWKNFVHDHGLVEKQDF
VTLWVFRNADNGSLCFVISSRRLPVYETIKKRRLRSN
Download sequence
Identical sequences MDP0000197534 MDP0000197534|PACid:22639927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]