SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000197862 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000197862
Domain Number 1 Region: 203-447
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 9.81e-80
Family Cryptochrome/photolyase FAD-binding domain 0.0000000183
Further Details:      
 
Domain Number 2 Region: 5-202
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.55e-37
Family Cryptochrome/photolyase, N-terminal domain 0.0000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000197862
Sequence length 706
Sequence
MGSAKTIVWFRRDLRIEDNPALAAADRDGSVFPVYVWCPKEEGQFYPGRVLRWWLKQSLA
HLDQSLKSLGAELVLIXTQSTLAALLVCIQAIGATKVVFNHLYGMFRDLSQQDSSRRFLS
LFIYSIPDPVSLIVDHNIKGKLVELGISVQSFNADLLYEPWEVYAGKGQAYTTFEAYWDK
CLHMQRELVIRFPPWKLMPATGRAWSPXWSNADKALSEFLELHLLDYSNNRVKVGQNSTS
LLSPYLHFGELSVRKVFQSARMKQIMWAKEGNSTGEETDQANFKAWRQGRTGYPLVDAGM
RELWATGWIQNRIRVIVSSFTVKVLLLPWRWGMKYFWDTLMDADLESDILGWQYISGSLP
DGHELEHLDSPEXQGSKFDPEGEYVRHWLPELARLPTEWIHHPWESPDSVLKFSGVEFGF
NYSKPIIELDLARERFTKAIFKMWDMEAAAKAASANGTDEVVVDNSASEDLPIPKVILKK
TSPCPTDSXNDQKVPTRQNSKSNQXNRKRSKFMQDESPLPDNRHNPKKXGPSRTNEGVSS
TAKSSMSKKQTNSRNSFSVPQSYSASEGNPFMECESSEMQQSWQEQINMEQTSRKNVXGS
VFCVSISVEEPWKMKASDSELIATLLSSSRKRTVLDIAVNTGTLADIRCADGTXRDGTER
MFCVCLVXAGRNXMXDFLEPVNIGSNEIVSMNKTAKMVLFMVAMXC
Download sequence
Identical sequences MDP0000197862 MDP0000197862|PACid:22656385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]