SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000241386 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000241386
Domain Number 1 Region: 72-164
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-18
Family B3 DNA binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000241386
Sequence length 193
Sequence
MVVLRRTDALILNIHMFLASVRIFSIYSPHVIGVCRQALADSVAEAEDPQMGDQPTSNPP
IELQGDEFWPLSEKPFFEVVIAKANVKPSYQMVIPAKFQQTLPSCSIHTVLMFGGKNWEM
TYTCGSGQRKFDTNWREFVNDNNLKVGDACVFELLECSSTKLIFRVQILRGDIPSELLRK
LKGETVDAPIIID
Download sequence
Identical sequences MDP0000241386 MDP0000241386|PACid:22625419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]