SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000247573 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000247573
Domain Number 1 Region: 141-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000314
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000247573
Sequence length 263
Sequence
MEGTMLSAGQTLGRSKPRPQLRRSSHDEVSTVLALWDPTWPTSFSTNNDDNKKKRKADQV
PDQPSPNTSPHDRDETTNSSSKRQKLVSTLPPFPTGDRFRDLGHENNMTNNNKNITTKEE
QMKRNKRDELVIANLNFMDSWEIKKKLTARDLTHFYVPANLMNKHILPYADDKFTKALEN
RQGAEITFLDGDTHTICHQYVFKQSDNSYIFVWHPAFVKRRQLRKGDKIGLHWLKTNSKP
VLFFSLLERATKQRPAPLATVDL
Download sequence
Identical sequences MDP0000247573 MDP0000247573|PACid:22627980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]