SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000249417 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000249417
Domain Number 1 Region: 127-224
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-22
Family B3 DNA binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000249417
Sequence length 236
Sequence
MVTAKSKLSYEESRQQRLEENKKRMEALNLPMLAQALNKTPNSPKPSPMKRAGKPRTYEV
QMVEVRRSTRVANRPAPDYKEVVAERVMIPRRSYXTNRHRDVANRVYASDEARAAAMVKA
DELEASLGSDHPTLVKTMLQSHVTGGFWLGLQVSFCKNHLPKGDEVMXLIDEDGDEYPTI
YLARKTGLSGGWKGFAVAHDLVDGDALVFQLIRPTTFKVYIIRVERPGQASSEGST
Download sequence
Identical sequences XP_017178215.1.92800 XP_017184860.1.92800 MDP0000249417 MDP0000249417|PACid:22680044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]