SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000260620 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000260620
Domain Number 1 Region: 24-73
Classification Level Classification E-value
Superfamily TSP9-like 0.00000000000536
Family TSP9-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000260620
Sequence length 533
Sequence
MASLTMVFPPVVTGRATGQVYAATEAKGGSKQEKGPFDWILGGLAKEDQLLEVDPILKKV
EDKNGSVSGGKGTVNLGAENVLTKXALYLSRHSAASELSSAAVPAIQNRKTKPNQQEEIP
RKDHHHPIQRXPLRKSTQKTHDWFDLIRIQNIKQIQSPXRQXLQSPNISARKPHXVRHLR
HQKRRLLLRVXTPPLHXRYKLXRLRLLKXLELVAEILHHXRVLRGARHXRRNRQPLLLPI
DLDAPIPGLGVDAVPRRLFWRSVMMARWTTAXAVXXSAXLRSRKXXPTXSPVKERTGRVA
XSAETERXLEXLREXXGARAERGLWEEEGRKIEELKKESDKXAAEVAIVGELXLDFQXII
LLXLLYRVVVSDKXDAFTRSSLNEIAEKLMLEEPNKEKWTPFSVLFKPHHNSLTGNYDIN
VLIAALEDKGKNVVWHDRRNGASSIDLDGPEDANLMGILLNVPVRMFAGLWKSRHWVTLR
KIGGVWYNLDSELVAPEVFEDAEKIEAKYRGERRIQEIGGRDAXEMYTEWYII
Download sequence
Identical sequences MDP0000260620|PACid:22634498 MDP0000260620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]