SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000275889 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000275889
Domain Number 1 Region: 150-299
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 6.28e-52
Family Cryptochrome/photolyase FAD-binding domain 0.000000477
Further Details:      
 
Domain Number 2 Region: 6-149
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 4.45e-36
Family Cryptochrome/photolyase, N-terminal domain 0.00000948
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000275889
Sequence length 450
Sequence
MGSAKTIVWFRRDLRIEDNPALAAAXRDGSVFPVYVWCPKEEGQFYPGRVLRWWLKQSLA
HLDQSLKSLGAELVLIXTQSTLAALLVCIQAIGATKVVFNHLYDXLYEPWEVYAGKGQAY
TTFEAYWDKCLHMQRELVIRFPPWKLMPATGMRELWATGWIQNRIRVIVSSFTVKVLLLP
WRWGMKYFWDTLMDADLESDILGWQYISGSLPDGHELEHLDSPEXQGSKFDPEGEYVRHW
LPELARLPTEWIHHPWESPDSVLKFSGVEFGFNYSKPIIELDLARERFTKAIFKMWDMEA
AAKAASANGTDEVVVDNSASEDLPIPKVILKKTSPCPTDSXNDQKVPTRQNSKSNQXNRK
RSKFMQDESPLPDNRHNPKKXGPSRTNEGVSSTAKSSMSKKQTNSRNSFSVPQSYSASEG
NPFMECESSEMQQSWQEQINMEQTSRKNGN
Download sequence
Identical sequences MDP0000275889|PACid:22647454 MDP0000275889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]