SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000279905 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000279905
Domain Number 1 Region: 15-55
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.000000262
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000279905
Sequence length 58
Sequence
MADERDAAAGSGGSLVFAVNGERFELPTVDPSTTLLAFLRSQTRFKSVKLSCGEGLSL
Download sequence
Identical sequences MDP0000274749 MDP0000279905 MDP0000468843 MDP0000274749|PACid:22645123 MDP0000279905|PACid:22672332 MDP0000468843|PACid:22620819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]