SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000290378 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000290378
Domain Number 1 Region: 5-90
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.31e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000290378
Sequence length 96
Sequence
MKKLKLKEYKIDLKEYGPMVLESLIKIKNEMDPTFTFRRSCRERIYGSCAMNIDGCNGLA
CLTKIVSSEAGTSMIMSLPHMFVIKDLLVDMMNFYN
Download sequence
Identical sequences MDP0000290378|PACid:22663371 MDP0000290378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]