SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000299780 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000299780
Domain Number 1 Region: 24-92
Classification Level Classification E-value
Superfamily TSP9-like 1.23e-20
Family TSP9-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000299780
Sequence length 92
Sequence
MASLTMVFPPVVTGWATGQVYAATAAKGGSKEEKGLLDWILGGLAKEDQLLEVDPILKKV
EDKNGTVSGRKGTVVVPPKKXGGFGGLFAKKD
Download sequence
Identical sequences MDP0000299780|PACid:22682296 XP_008355306.1.92800 MDP0000299780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]