SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000303852 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000303852
Domain Number 1 Region: 331-470,503-571
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 1.31e-61
Family Transcriptional factor tubby, C-terminal domain 0.0000838
Further Details:      
 
Domain Number 2 Region: 215-263
Classification Level Classification E-value
Superfamily F-box domain 0.00000654
Family F-box domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000303852
Sequence length 693
Sequence
MGDRRSEEEYGSNGFFVVPLPFMGSLKPLVSSIKFGNQPNEQKKSRTRSPFSRSKQRRRK
MMKXKNVVVVLVLCVIFSGMENAVVDSAAVDCYDACSTGCVQRDTRLMARCDRKCQIRCG
PDVWPRKLCHEDNNASNSTPYAQAKWKSEDFEEDTQLFLVLLSTTRMSFRSIVRDVRDGF
GSLSRRGFEVRLTGHHRGKSHGSLNDLHDQPLIVQNSRWASLPPELLYDVIRRLEESEST
WPSRKHVVACASVCRSWRIMCKEIVKKPEICGKLTFPVSLKQYYQTLMVRLCEGLPSPKG
FRPSEEEIYYKHYVGGIKNALHEHCKALLVENGKFLLSAKRTRRTTCTEYVISMDADNIS
RSSSSYIGKLRSNFLGTKFIVYDTQPAYTSEHVPPPGRXSRRFNSKKVSPKVPTGSYNIA
QIAYELNVLGTRGPRRMHCIMHSIPVSSLDAGSTVPGQPELLTRALEDSFRSISFSKSLD
HSVEFSSSRFSEIAGPRDDVDSKTRPLVLKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQ
LIAATQPAASAPTPSQPAPPDLDKIILQFGKLVILCVGEWRRVVADDALEDGGCHNHAVG
RDGIMASDINIFANILTNLCINITTITDILNTVFKSKTSNPSWSPDEEQSLHKSWPGHRA
NPKLGEPSRDHGLLIATSMKLDPFVRIRRISTI
Download sequence
Identical sequences MDP0000303852|PACid:22674729 MDP0000303852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]