SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000306704 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000306704
Domain Number 1 Region: 31-186
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000324
Family GDI-like N domain 0.00017
Further Details:      
 
Domain Number 2 Region: 239-263,324-361
Classification Level Classification E-value
Superfamily F-box domain 0.0000116
Family F-box domain 0.014
Further Details:      
 
Weak hits

Sequence:  MDP0000306704
Domain Number - Region: 339-561
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00575
Family Galactose oxidase, central domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000306704
Sequence length 589
Sequence
MWSAKAVRFKQFFALMHCILYSTHGHRLTRIKIVHSNVHKVPTTDMEALKPLLMGLFEKR
RAFKFIIYVQDYSETDPKTREGMDLTRVTTRDLIAKYGLDDNTVDFIGHALALHRDDCYL
NEPALDIVKRMKLEFNEEGKVIGVTYEGETTKCKKVVCDPSYLPNKVRNVVKVAKAIAIM
SHPIPNTNESHSMQVLDFSVDLSAAEEGIAKLHVVLELIIVLCSKCTELLKLPYLWRWCV
SKSWRSLVTDPDFVKIHLNKAFENVEIFHQRRRLMFSDGSHRSLYSLDLDEFLNHNDAVH
NYLDEKENDNDINTNDDDDEAVATELDYIYSEIPNNWVFMVFHCNGLLLCQLYNWEFYLV
NPATRKSKKLPDIPSSSIAYYFDLFGFGFDHSTDDYKMVDLRYLKGGIMFIVYTLKTGSW
REIQRRYPYKSDLMLHGILLSGGLHWLVNRVRGSSSVIISFDLAEEHVQEIPLPCDLVDA
KGYIVGVFRQMLCLTRCDGQTHNEFWIMKEYGVRESWTKVRISMPYSLLLHSGFKRKNHD
LLVFKDRLFMYNFNGERFRKLSVSGFPIVTEVGIYLESLVSPNSCSGGC
Download sequence
Identical sequences MDP0000306704|PACid:22680179 MDP0000306704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]