SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000393956 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000393956
Domain Number 1 Region: 54-168
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-16
Family B3 DNA binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000393956
Sequence length 173
Sequence
MRTPLLRGQEEDHHPSKVRLFGVGLDNSLNDPRGGHEPSTDLYLWDPTWDYNSIWKIRKR
LAASDLGELSRLLMPKEAVQKHVMSYLDDKLAKMVDSKEGLTVTVVDWDTCNRHELTFKH
WNSGDFYVLNGGWRPEFMVRRGLKENDEIGLYLDWDWKTSKCIFRFSVLRRAK
Download sequence
Identical sequences MDP0000393956|PACid:22650070 MDP0000393956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]