SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000540442 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000540442
Domain Number 1 Region: 57-167
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000883
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000540442
Sequence length 212
Sequence
MQKMSLKNNTKKGVDTMNIALKKKELITPSASLGYHDLPEEFKREIERLNGTKVELVIEK
QLTKTDISSSTNRMSMPLNQLISISFLEDEDKEMLENCKTMTVQLIDPGLVQGDINLRRL
VMGKEKKPGSAIFVLRTQWGDVARKNKLKAGDVVQVGRFRGAVLDEIIRRVMMMVIASVR
VVLLMAGVVNSGGSEGGAEIMEEWKRWWQLLE
Download sequence
Identical sequences MDP0000540442 MDP0000540442|PACid:22682667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]