SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000626995 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000626995
Domain Number 1 Region: 53-247
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.64e-46
Family Thi4-like 0.0000000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000626995
Sequence length 312
Sequence
MASMTSTLTSSSLTTKLQKPSLLDSSFHGAPMVRLQPAKAAPASNGGLSVSMSANGLNPS
YNLSAFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQV
AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEQDNYVVIKHAALFTSTIM
SKLLARPNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSS
CGHDGPMGATGVKRLRSVGMIESVPGXKALDMNTAKDTIVKLTREIMPGXIVTGMEITEI
NGSPRMVHFYLI
Download sequence
Identical sequences MDP0000626995|PACid:22630905 XP_008386070.1.92800 MDP0000626995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]