SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000685403 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000685403
Domain Number 1 Region: 319-436
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000012
Family B3 DNA binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000685403
Sequence length 439
Sequence
MGYSRPLLFFILPIILGLHAPAIADDVDNGVCTTTADYCWSCSGTNETFNNGSNYERNLH
TILSSFSSNKTEINSGFYNSSLGQGPEKVNAMALCRGDVPLNDCHTCFNESISILRQNCT
NQKQATIWAQRCTVHYSNVSIFGVAEDDPVKFVPGPTNAPNAEQFKQVLNPLVVNLSGTA
AAGDSMKKFAAGHALVPATNQTIYAIVQCTPDLDRQNCSECLDEAISDIPQCCEGKEGGR
VLRPSCNLRFESNLFYDAASDSLVNLPGKQAMKLEEEDHHPSNVRLFGVGLGSSLNDPRG
GHEPSTDLYLWDPTWDYSSIWKIRKRLAASDLGELSRLLMPKEAVRKHVMSYLDDKSAKM
VDSKEGLPVTIVDWDTCNRRELTFKHWNSGDFYVLNGGWRPEFVVRRGLKENDEIGLYLD
WDWKTSKYIFRFSVLQRAK
Download sequence
Identical sequences MDP0000685403 MDP0000685403|PACid:22642568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]