SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000777125 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000777125
Domain Number 1 Region: 141-242
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000549
Family B3 DNA binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000777125
Sequence length 259
Sequence
MEGTTLSTRLTLGHPHPQPRRSSHDEVSTVLALWDPTWPTSFSTNNDNNTKRKANQVPDQ
PSPTSTSPHHRDQTTNTSSKRQKLVSTLSPFPTGDCLRDRVHDNKMTNNNKNTATKEEQM
KWKKRDELVIANLNFKDSWGIKKKLTARDLIHFYMPASLMNKYILPHVNDEFTKALENRQ
GAQITFHDGDTHTTHHRYIFKQSNNSYVLVWHPAFVKRRQLKEGDEIGLHWFKTNSKLVL
LFSLLERGNQTAPCTSCNP
Download sequence
Identical sequences MDP0000777125|PACid:22671632 MDP0000777125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]