SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000794899 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000794899
Domain Number 1 Region: 72-150
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000255
Family B3 DNA binding domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000794899
Sequence length 195
Sequence
MKPYERDVTEVLFLVSHSKAEIVDMLRKHSYANELEIYKYKLYNGGAVGLDDGGKRMKHY
LDLRDMCSRGRELLFEKVXTPSDVGRLNRMVIPKQHAEKHFQVHLXVGFGKGVLLKFEDE
VGKEKKLKVGDVVKFERSVGEDKKMFIYCRLRNLDMSGIREMHGRVGDPLRTVQDHGAVR
LFGVNISWKPVHCRE
Download sequence
Identical sequences MDP0000794899 MDP0000794899|PACid:22625108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]