SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000817915 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000817915
Domain Number 1 Region: 86-173
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.04e-16
Family 2Fe-2S ferredoxin-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000817915
Sequence length 199
Sequence
MVALQLSSCWSSFCSLPFNLINSNITNSHSTLRPSKPLISFSRAKIRAVSTSQESQSEAI
QPEQPPSVDFAFVSSVLLPDQTPDVHLRQACGGQKLRNIMLDSNIDLYGPYSRVLLNCAG
GGTCGTCMVEIVQGKELLTPRTDKEKEHLKKKPKNWRLACQTTVGKPDSRGLVVVQQLPE
WKAHEWKYEEVLVDPNQSS
Download sequence
Identical sequences MDP0000817915|PACid:22665239 MDP0000817915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]