SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000913001 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000913001
Domain Number - Region: 37-91
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00243
Family FAD-linked reductases, N-terminal domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000913001
Sequence length 93
Sequence
MTTWHIRVSIGSNFIGKQLRARSRRGRSSCNKSDLTQDGFIYDLQQEDDGKTPVERIMTE
DGIPTVRGRVLGGASVINTRVYTRANMSFYNES
Download sequence
Identical sequences MDP0000913001|PACid:22652008 MDP0000913001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]