SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc00g016470.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc00g016470.1.1
Domain Number - Region: 12-60
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0141
Family B3 DNA binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc00g016470.1.1
Sequence length 62
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch00 gene_region:11349292-11349751 transcript_region:SL2.40ch00:11349292..11349751- functional_description:"Unknown Protein (AHRD V1)"
Sequence
MAFREFESLLALHCSKGAAMLSKMLAYDFGEKIGHFPTLVDPNNNQFKVLVEKINGCMFL
NT
Download sequence
Identical sequences Solyc00g016470.1.1 Solyc00g016470.1.1 Sopim00g016470.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]