SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc01g028810.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g028810.2.1
Domain Number 1 Region: 237-429
Classification Level Classification E-value
Superfamily GroEL apical domain-like 7.33e-74
Family GroEL-like chaperone, apical domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 63-188,459-577
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 4.2e-71
Family GroEL chaperone, ATPase domain 0.0001
Further Details:      
 
Domain Number 3 Region: 194-249
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00000000000549
Family GroEL-like chaperone, intermediate domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g028810.2.1
Sequence length 599
Comment genomic_reference:SL2.40ch01 gene_region:33327242-33332361 transcript_region:SL2.40ch01:33327242..33332361- go_terms:GO:0044267,GO:0005737 functional_description:"chaperonin (AHRD V1 ***- B4VMY1_9CYAN); contains Interpro domain(s) IPR001844 Chaperonin Cpn60 "
Sequence
MASTFAGMSSAGPLAAPSTSSNKLSSVANISSTSFGSKRNVALKKSRRPTILAAAKELHF
NKDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAREVELEDPV
ENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTAKA
LVAELKNMSKEVEDSELADVAAVSAGNNLEVGSMIAEAMSKVGRKGVVTLEEGKSAENSL
RVVEGMQFDRGYVSPYFVTDSEKMSVEYENCKLLLVDKKITNARDLVNVLEDAIRNGYPI
LIIAEDIEQEALATLVVNKLRGALKVAALKAPGFGERKSQYLDDIATLTGGTVIREELGL
TLDKADKEVLGHAAKVVLTKDATTIVGDGSTQEAVNKRVAQIKNLIEAADQDYEKEKLNE
RIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAKVD
AIKGTLANDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSSDDPKFGYNAATGN
YEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEAAVAGNPMDNSGYGY
Download sequence
Identical sequences K4AV63
Solyc01g028810.2.1 Sopim01g028810.0.1 XP_004228946.1.44838 Solyc01g028810.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]