SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc01g090750.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g090750.2.1
Domain Number 1 Region: 13-142,409-535
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 4.19e-82
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00023
Further Details:      
 
Domain Number 2 Region: 210-382
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.09e-46
Family Group II chaperonin (CCT, TRIC), apical domain 0.00034
Further Details:      
 
Domain Number 3 Region: 147-216,375-408
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 9.16e-29
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc01g090750.2.1
Sequence length 545
Comment genomic_reference:SL2.40ch01 gene_region:76162903-76172451 transcript_region:SL2.40ch01:76162903..76172451+ go_terms:GO:0051082 functional_description:"T-complex protein 1 subunit alpha (AHRD V1 ***- B9SF60_RICCO); contains Interpro domain(s) IPR012715 T-complex protein 1, alpha subunit "
Sequence
MAYSAQTLDISGDRQSGQDVRTQNVTACQAVANIVKSSLGPVGLDKMLVDDIGDVTITND
GATILRMLEVEHPAAKVLVELAELQDREVGDGTTSVVIIAAELLKGANELVRHKIHPTSI
ISGYRLAMREACKYVEEKLAVKVDKLGKDSLINCAKTSMSSKLIADDSDFFANMVVEAVQ
AVKMTNVRGEIKYPIKGINLLKAHGKSAKDSYLLKGYALNTGRAAQGMPLRVAPARIACL
DFNLQKTKMQMGVQVLVTDPRELERIRQREADMTKERIQKLLSAGANVVLTSKGIDDMAL
KYFVEAGAIAVRRVRKEDLRHVAKATGATVVSTFADMEGEETFEPSFLGHADEVVEERIA
DDDVIMVKGTKTSSSVSLILRGANDFMLDEMERALHDALCIVKRTLESTTVVAGGGAVEA
ALCVYLEYLATTLGSREQLAIAQFAESLLVIPKVLANNAAKDSSDLVSKLRSCHYLAQTK
ADKKHLSSMGLDLSKGTVRNNLEAGVIEPAMSKVKIIQFATEAAITILRIDDMIRLVKDE
SQNDE
Download sequence
Identical sequences K4AZ16
XP_004229777.1.44838 XP_015062283.1.21931 Solyc01g090750.2.1 Solyc01g090750.2.1 Sopim01g090750.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]