SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc01g103050.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g103050.2.1
Domain Number 1 Region: 117-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-43
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 542-617
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000294
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc01g103050.2.1
Sequence length 654
Comment genomic_reference:SL2.40ch01 gene_region:83494825-83500792 transcript_region:SL2.40ch01:83494825..83500792+ go_terms:GO:0005515,GO:0003700 functional_description:"Auxin response factor 1 (AHRD V1 **** D9I2J0_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MAHVAANHFGGGTHPGASANNALYKELWHACAGPLVTVPREGERVYYFPQGHMEQLEAST
HQGVDQHLPSFNLPAKILCKVMNVQLRAESETDEVYAQITLLPEPDQGEITSPDPPLPEP
EKCTVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSQQPPWQELVASDLHGNEWHF
RHIFRGQPRRHLLTTGWSVFVSAKKLVAGDAFIFLRGDSGELRVGVRRLMRQLNNMPSSV
ISSHSMHLGVLATASHAIMTGTLFSVFYKPRTSQSEFIVSVNKYLEARNHKLSVGMRFKM
RFEGEEVPERRFSGTIVGVGDNPSSRWPDSEWRSLKVHWDEPSSILRPDRVSPWDMEPLV
AATPTNTQPPQRNKRARPSVLPSPVQELPALGMWKSPVDSPSSFSYCDPSRGRDLYPSPK
LSSAAKGLGYGENGSMPLSTKTMYWSSQSETCTESVAPASEKRPANGCRLFGIELLDCPT
IDESSSVAMPSAVVEDQPVPSLNVDSDRNSEPSNPIPSVSCEPEKSSLRSTHESQSKQIR
SCTKVHMQGKAVGRAVDLTRLDSYEDLLKKLEVMFEIEGELRGSTKKWQVVYTDDEDDMM
MVGDDPWHEFCSMVRKIYVYTAEEAKKLSPKIKLPVVDVKPVSDGATVGNNEKA
Download sequence
Identical sequences K4B1N1
Solyc01g103050.2.1 NP_001234871.2.44838 Sopim01g103050.0.1 Solyc01g103050.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]