SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc01g108120.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g108120.2.1
Domain Number 1 Region: 59-155
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-21
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g108120.2.1
Sequence length 295
Comment genomic_reference:SL2.40ch01 gene_region:87238627-87242710 transcript_region:SL2.40ch01:87238627..87242710+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein At3g19184 (AHRD V1 *-*- Y3918_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MKDRSLELKGWHKQVVCKKPKKLGSCKKKMAMMHNLYGQIDLATSAKYRAEEVLSRLSTK
YPSFMKPMIRSNVSGGFWLSLPRLFCQLHMPRHDITVTLVDESQEEYKTKYLAERNGLSG
GWRGFSLSHDLVEGDVLVFQLFRFCKLKVYMVRANYLAEVDAALVLLHLDAHHKQIDPVH
QRQHSISMKQVGIKRQRLSSQEGDDYSTENMLHKHSHSTNMFKNLDLPSKGLAYETLTIV
DAVKASKLSDPPNGTFSSWNTRPTELEQLEVRPFSSGYSIEPALTLSGAEMIFRP
Download sequence
Identical sequences K4B328
XP_004230781.1.44838 XP_010315232.1.44838 Solyc01g108120.2.1 Solyc01g108120.2.1 Sopim01g108120.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]