SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g021250.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g021250.1.1
Domain Number 1 Region: 67-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000133
Family B3 DNA binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc02g021250.1.1
Sequence length 107
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:13019356-13020015 transcript_region:SL2.40ch02:13019356..13020015+ functional_description:"Unknown Protein (AHRD V1)"
Sequence
MHRKQLKEVKTETKDLEEHCNRIAVVDPSVTKRTITIRHDHEKLRRRYQLRSKQCKDVKL
EKGEDTNKDKFYKGKGWREFVMVNNIKEDDTCDYSPSHNHSLLKYVL
Download sequence
Identical sequences K4B4X5
XP_010315604.1.44838 XP_010315606.1.44838 Solyc02g021250.1.1 Solyc02g021250.1.1 Sopim02g021250.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]