SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g055370.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g055370.2.1
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.04e-18
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc02g055370.2.1
Sequence length 122
Comment genomic_reference:SL2.40ch02 gene_region:26262372-26263045 transcript_region:SL2.40ch02:26262372..26263045+ go_terms:GO:0006355 functional_description:"Transcriptional factor B3 family protein (AHRD V1 ***- D7LIC1_ARALY); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MEIPPKKPHFFKPILPGFKNGLKIPLGFLKYLKRHDQHEHAILTTDDKKWLVKVNGRRLE
EGSWIEFVEELNLKVGDVLVFKHEGDMEFDVFKFDLSHHCDKEYAMYQEEDEDEDEEDED
KL
Download sequence
Identical sequences K4B626
Sopim02g055370.0.1 Solyc02g055370.2.1 XP_004231728.1.44838 Solyc02g055370.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]