SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g062380.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g062380.1.1
Domain Number 1 Region: 212-270
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000219
Family Erythroid transcription factor GATA-1 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc02g062380.1.1
Sequence length 289
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch02 gene_region:28563645-28566551 transcript_region:SL2.40ch02:28563645..28566551- go_terms:GO:0031013,GO:0030674 functional_description:"GATA transcription factor 9 (AHRD V1 *-*- B6STZ1_MAIZE); contains Interpro domain(s) IPR000679 Zinc finger, GATA-type "
Sequence
MKFYPHVVYMVPVCYVFGQVTQQIFKQKMDYSGNCQSFVSGDDLFVDELLDLSNGFSEDE
ENENENNNSSSSQQIKECDKETVIIPSGKQDFGSLLGCEISLPGADLDNLEWLSHFVEDS
FSEYSLTYSAGNLPGKSLKLHSNVEIPVREKPCFTAPLGAEREKNKPPSMSFSSSSSTTA
NSFWGELSVENKPAARKPKKKMEKRIGIGAKQCSHCGVQKTPLWRTGPLGEKTLCNACGV
RFKSGRLLPEYRPASSPTFSTGLHSNSHRKVLEMRQKKETEPGPPVQSF
Download sequence
Identical sequences K4B6C7
Sopim02g062380.0.1 Solyc02g062380.1.1 Solyc02g062380.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]