SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g065340.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g065340.1.1
Domain Number 1 Region: 172-273
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000844
Family B3 DNA binding domain 0.0098
Further Details:      
 
Domain Number 2 Region: 6-101
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000334
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc02g065340.1.1
Sequence length 278
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:31083439-31084553 transcript_region:SL2.40ch02:31083439..31084553+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein REM14 (AHRD V1 ***- REM14_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MLVDPNKHPSFCKLLFKQGFMDKIMPPIFIKENKKLLAKTCLLKTNVVGMSWETKIVREN
SNYFICEGDWPQFVVHHKLELGDILIFFLIDKSTFHVLPYSQKTFKNSSGRGAFQELTSS
SEEEHDVGIARKLKKMKMEQKESSGVVKKEEAEGGKEENVPKTTRFSVININNKDPYFEM
VVRKTHSFFMTIPKSFAIWTGITKMKKMRLVNGNGNKWKLVDIVHTQQRVYMKRGWAGFR
TLNRIGNGQTCRFKLIKENCCEYSVLQVQKIHKSKCLK
Download sequence
Identical sequences K4B6W8
Solyc02g065340.1.1 Sopim02g065340.0.1 Solyc02g065340.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]