SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g068730.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g068730.2.1
Domain Number 1 Region: 43-177,449-566
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 6.32e-66
Family GroEL chaperone, ATPase domain 0.00048
Further Details:      
 
Domain Number 2 Region: 225-417
Classification Level Classification E-value
Superfamily GroEL apical domain-like 7.5e-63
Family GroEL-like chaperone, apical domain 0.00000951
Further Details:      
 
Domain Number 3 Region: 178-245
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00000000000000181
Family GroEL-like chaperone, intermediate domain 0.0013
Further Details:      
 
Weak hits

Sequence:  Solyc02g068730.2.1
Domain Number - Region: 405-449
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00229
Family GroEL-like chaperone, intermediate domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc02g068730.2.1
Sequence length 583
Comment genomic_reference:SL2.40ch02 gene_region:33243641-33248793 transcript_region:SL2.40ch02:33243641..33248793- go_terms:GO:0042623 functional_description:"chaperonin (AHRD V1 ***- B2IXD2_NOSP7); contains Interpro domain(s) IPR001844 Chaperonin Cpn60 "
Sequence
MSLSMCSPLYSPLKLSFKEDKGKGNSWGLRQSLGKKKLMVVRAGPKRIAFDKECRRALLS
GINKLADAVSVTLGPRGRNVVLSEAGGLKIINDGVTIAQAIELPDTIENAGATLIQEVAT
KTNRLAGDGTTTAIVLAREMIKAGLLAVDFGANPVSMKKGMDQTVRELVNTLKKKSHPVR
GNDDIKAVASISAGNDEFIGSLIAEAINKIGPDGVICIESSSSAETSIMVEEGMKIDKGY
MSPHFINNPEKSIVEFENAKVLVTDQKICSVKEIVPLLEKATQLSVPLLIFAEDITNQVL
ETLVINKMQGMLNVAVVQCPGFRDGKKGVLQDIAMLTGADFLSGDLGLTLESATSDQLGI
ARKITITSNSTTIVAHPSTKAEIQARIMQIKKDLAETDNKSISEKLSQRIAKLSGGVAIL
KVGAHTETELEDRKLRIEDAKSATFAAMDEGIVPGGGATFIHLSEQIPLIKESFQDPDEQ
IGADIIGTALLAPAKLIAANAGVDGDTVVEKVRGCDWKMGYNAMTGRYEDLLASGIIDPC
RVSRCALQNAVSVAGIVLTTQAIMVEKTKEPKPLVPYVPGITP
Download sequence
Identical sequences K4B7K5
XP_004233243.1.44838 Sopim02g068730.0.1 Solyc02g068730.2.1 Solyc02g068730.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]