SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc03g031970.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g031970.2.1
Domain Number 1 Region: 111-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-49
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 720-791
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000687
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc03g031970.2.1
Sequence length 844
Comment genomic_reference:SL2.40ch03 gene_region:8739906-8747501 transcript_region:SL2.40ch03:8739906..8747501+ go_terms:GO:0003700 functional_description:"Auxin response factor 8-1 (AHRD V1 **** E0A8P3_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MKLSTSGMGQQAHEGENKCLNSELWHACAGPLVCLPTVGSRVVYFPQGHSEQVAATTNKE
VDIHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTLQEQKDTYLPVELGIPS
RQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQTPPCQELIARDLHDIEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLFLGIRRATRPQTVMPSSVL
SSDSMHIGLLAAAAHAASTNSCFIVFFNPRASPSEFVIPLSKYIKAVYHTRVSVGMRFRM
LFETEESSVRRYMGTITGIGDLDPVRWANSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TFPMYPSLFPLRLKRPWYPGTSSFQENNSEAINGMTWLRGESSEQGPHLLNLQSFGGMFP
WMQQRVDPTMLRNDLNQQYQAMLASGLQNFGSGDLMKQQLMQFPQPVQYVQHAGSVNPQL
QQQQQQQETMQQTIHHHMLPAQTQDNLQRQQQQHVSNQTEEQSHQHSYQDAYQIPNSQLQ
QKQPSNVPSPSFSKPDIADPSSKFSASIAPSGMPTALGSLCSEGTTNFLNFNIIGQQPVI
MEQQQQQKSWMAKFANSQLNMGSSSPSLSGYGKETSNSQETCSLDAQNQSLFGANVDSSG
LLLPTTVSNVATTSIDADISSMPLGTSGFPNPLYSYVQDSTDLLHNVGQADAQTVPRTFV
KVYKSASLGRSLDITRFNSYHELRQELGQMFGIEGFLENPQRSGWQLVFVDRENDVLLLG
DDPWEEFVNNVWYIKILSPEDVQKLGKEEVGSLNRGPPERMSSNNSADGRDFMSGLPSIG
SLDY
Download sequence
Identical sequences K4BFG8
Sopim03g031970.0.1 Solyc03g031970.2.1 Solyc03g031970.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]