SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc03g042500.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g042500.1.1
Domain Number 1 Region: 9-95
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000334
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc03g042500.1.1
Sequence length 203
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch03 gene_region:10823243-10824821 transcript_region:SL2.40ch03:10823243..10824821+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein At1g49475 (AHRD V1 *-*- Y1475_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MRHLGARPILRILVVFSKRHCENKFNPVFLEFPHGKAWEVEVDNSQGQIWLAKGWSDFCD
YYSISVKSLLMFTYNPRSHFVVAIYDQSTTEIEYPIDQDIESDEQEEDILVSQGNANVID
EDILILQSNAYVIEEDIPIFQSNANVIKDEKEDIPVNCPQTNANVFEQHKEVGEANNICE
KVVPNNYSSQYILVDLTGDNPFF
Download sequence
Identical sequences K4BFX1
Solyc03g042500.1.1 Solyc03g042500.1.1 Sopim03g042500.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]